Welcome to Pretty In Pink Gift Shop " Be Wish"
Default Language
Spanish Spanish
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Summer Letter Printed Dress
Summer Letter Printed Dress
Summer Letter Printed Dress
Summer Letter Printed Dress

Summer Letter Printed Dress

Product Code: STQ060622
Product Condition: New
Units in Stock: 3
weight: 250.0g
$8.55 inc. tax
$7.99 ex. tax
? Tax based on Texas, United States.
 Add to Cart
Description

Color: Red (S)，Black (M)，White (M)

Decoration: Letter，Print/Printed

Season: Summer

Trends: Body Vibe

Length: Mini

Closure Type: Pullover

Wash&Care: Hand Wash，Machine Wash

Style: Sexy & Club

Neckline: Scoop Neck

Fabric Content: 51%-70%

Fabric: Spandex


Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i