Welcome to Pretty In Pink Gift Shop " Be Wish"
Default Language
Spanish Spanish
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Simple Pure PU Textured Handbag
Simple Pure PU Textured Handbag
Simple Pure PU Textured Handbag
Simple Pure PU Textured Handbag
Simple Pure PU Textured Handbag
Simple Pure PU Textured Handbag

Simple Pure PU Textured Handbag

Product Code: LTQ041411
Product Condition: New
Units in Stock: 3
weight: 300.0g
$6.42 inc. tax
$6.00 ex. tax
? Tax based on Texas, United States.
 Add to Cart
Description

Color: Orange, Green, Pink

Size: One Size

Decoration: Solid

Season: Spring，Summer，Autumn，Winter

Trends: Matching Addicted

Material: PU

Openway: Zipper

Shoulder Straps: One-Shoulder


Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i